PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000358.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 684aa    MW: 76972.8 Da    PI: 5.0941
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000358.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK47.92.7e-15512556448
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                               i+ ++l++ F ++  dAAk+L+v++++ Kr+CR +GI+RWP  k
  Itr_sc000358.1_g00007.1 512 GITRQVLEQLFGKNRDDAAKTLKVSTSTFKRACRDFGINRWPNHK 556
                              6999**************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.661491588IPR003035RWP-RK domain
PfamPF020426.9E-14513556IPR003035RWP-RK domain
SuperFamilySSF542771.86E-15593680No hitNo description
SMARTSM006664.6E-12600682IPR000270PB1 domain
PROSITE profilePS5174517.306600682IPR000270PB1 domain
PfamPF005645.4E-13601678IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.5E-15602681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MTLIENDDDD ASSFFDLFAE NLASPGLAPT YAASPSPTPT RWLFNHGGLT WNPVTEMRTA  60
ENAAAAALRE WEMSEEGESS VVNHPQRDGE EALFFTPNFL ADIGGGMIMS TSPLRMNCFS  120
PPSGDSIGNF DPYRLWNFAD HSGAQELENR KGMTMRPTWK QQQPCNEEDD YPQFLVIAEL  180
TIVALDCTVQ IKESGLQFVK PCLLSLECLC QNMVIELVNG EQIMRLNVNL KHAYLEVDFS  240
SEKSNAICSS QALELESWGG MIMEWISVNH QRRYAFCSKM RPWRVILELL DVVVRQLLYL  300
GENNYSFGIS VSSSSSSSSV NTKLQSVLYF ERTFLEMQHL NSLERQFLDH FERLVQTGVL  360
ELLSGEEIKL QYLQEGEVGS ASEENHSVSI LPPLLEAECR MMQLLGKRRR DILKVSSSTF  420
KRARRDFGIT RRSLEEVDSA SEENHTAQCN AAGTGGMLLQ QEDSSSEPHI PVPSATNEER  480
NNVVELKSID AKGGNSSSDK TDTISRWEKD HGITRQVLEQ LFGKNRDDAA KTLKVSTSTF  540
KRACRDFGIN RWPNHKGKRP NNGSLNQKHV QAVKKHKGIQ RCPALPPEEA TTTTLQGNSA  600
MSVKVTYEDN TIRFPLPSSS TMKYLEEQLE TRLKICLENF SIMYQDEEAD WISLTCDSDL  660
KCGMNVLRSS DKTVVKMKIK PNFG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13981711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-10NIN like protein 7